PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV47218.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 592aa    MW: 66648.5 Da    PI: 7.3659
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV47218.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.22.7e-2274164186
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                 f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F + +
  KZV47218.1  74 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLASGDAVLFLRAS 164
                 99****************************86333.45679***********************************************8544 PP

2Auxin_resp84.81.8e-281622261882
  Auxin_resp  18 rastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 ras+++F+v+++k+ k +++++ vG+Rfkm+f+ +ds+err+sG+v+gv d+dp+rWpnSkWr+L
  KZV47218.1 162 RASHADFIVPYQKYFKCTTSQIHVGTRFKMKFDLDDSPERRFSGVVIGVGDMDPYRWPNSKWRNL 226
                 89*************************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.2E-3667170IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.58E-4268180IPR015300DNA-binding pseudobarrel domain
CDDcd100172.80E-1972160No hitNo description
PROSITE profilePS5086311.82974176IPR003340B3 DNA binding domain
SMARTSM010191.0E-1874173IPR003340B3 DNA binding domain
PfamPF023623.1E-2074165IPR003340B3 DNA binding domain
PfamPF065073.9E-23162226IPR010525Auxin response factor
PROSITE profilePS5174516.551492572IPR000270PB1 domain
SuperFamilySSF542771.32E-8493561No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MESPAFDLPP QIFCRVVDVQ LLANKENDEV YSQLTLLPLR ELVGLELGGT ENGNEGVDED  60
GNVAGALKST SHMFCKTLTA SDTSTHGGFS VPRRAAEDCF PPLDYKEQRP SQELIAKDLH  120
GVEWKFRHIY RGQPRRHLLT TGWSIFVSQK NLASGDAVLF LRASHADFIV PYQKYFKCTT  180
SQIHVGTRFK MKFDLDDSPE RRFSGVVIGV GDMDPYRWPN SKWRNLMVRW DDDIVSNHQD  240
RVSPWVIEFS GVSSRLDFEE SVKSSKVLQG QENLAFVSPL CRNNRISRHL DFETRPPASN  300
PILDRMDKSN HTKFLRNPAP TTFTSFLQSN WLPEVLQGQE ICSLRSLSGK TDANLSVGSK  360
PELGFNALNA YQRPQLSFYP LASEGARKLL LDKSNYRVRH GPLMVSNFQR GTSVLNPNPA  420
LFKDIGDVGR MPYLGNELRA VEQTSPPPTS LMHLKNLDDD NYLKDKVPPC KLFGFSLTDD  480
LDAVNSQGPS KRSCTKVHKQ GSLVARAIDL SKLVGYEDLL TALERLFSME GLLRDPNNGW  540
HILYTDSEND MMVVGDDPWK RLGRFMGTYA DSSATPPRLA DQLFQCVRGR LG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_B1e-75424865353Auxin response factor 1
4ldy_A1e-75424865353Auxin response factor 1
4ldw_B1e-75424865353Auxin response factor 1
4ldw_A1e-75424865353Auxin response factor 1
4ldv_A1e-75424865353Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089885.10.0PREDICTED: auxin response factor 4 isoform X3
SwissprotQ9ZTX91e-172ARFD_ARATH; Auxin response factor 4
TrEMBLD7SKV90.0D7SKV9_VITVI; Auxin response factor
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.11e-164auxin response factor 4